SCOP 1.75: Domain d1ad0d2: 1ad0 D:114-211

Lineage for d1ad0d2 (1ad0 D:114-211)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (7 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88575] (172 PDB entries)
   Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3)
   SQ NA # humanized antibody
   Uniprot P01857 # IGHG1_HUMAN Ig gamma-1 chain C region
   SQ NA # engineered antibody
   including humanized antibodies (chimeric proteins with human constant domains)
   Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3) ! SQ NA # humanized antibody ! Uniprot P01857 # IGHG1_HUMAN Ig gamma-1 chain C region ! SQ NA # engineered antibody

8. Domain d1ad0d2: 1ad0 D:114-211 [21157]
   Other proteins in same PDB: d1ad0a1, d1ad0a2, d1ad0b1, d1ad0c1, d1ad0c2, d1ad0d1
   part of humanized Fab A5B7

Details for d1ad0d2

PDB Entry: 1ad0, 2.5 Å

PDB Description: fab fragment of engineered human monoclonal antibody a5b7

PDB Compounds: (D:) antibody a5b7 (heavy chain)

SCOP Domain Sequences for d1ad0d2:

Sequence; same for both SEQRES and ATOM records:

>d1ad0d2 b.1.1.2 (D:114-211) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapcsrstsestaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtktytcnvdhkpsntkvdkrve

Timeline for d1ad0d2:

• d1ad0d2 first appeared (with stable ids) in SCOP 1.55
  
• d1ad0d2 appears in SCOP 1.73
  
• d1ad0d2 appears in SCOPe 2.01
  
• d1ad0d2 appears in the current release, SCOPe 2.08