Lineage for d1ad0d2 (1ad0 D:114-211)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 8163Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 8462Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species)
  7. 8796Species Fab A5B7 (engineered human construct), kappa L chain [49039] (1 PDB entry)
  8. 8800Domain d1ad0d2: 1ad0 D:114-211 [21157]
    Other proteins in same PDB: d1ad0a1, d1ad0b1, d1ad0c1, d1ad0d1

Details for d1ad0d2

PDB Entry: 1ad0 (more details), 2.5 Å

PDB Description: fab fragment of engineered human monoclonal antibody a5b7

SCOP Domain Sequences for d1ad0d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ad0d2 b.1.1.2 (D:114-211) Immunoglobulin (constant domains of L and H chains) {Fab A5B7 (engineered human construct), kappa L chain}
astkgpsvfplapcsrstsestaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtktytcnvdhkpsntkvdkrve

SCOP Domain Coordinates for d1ad0d2:

Click to download the PDB-style file with coordinates for d1ad0d2.
(The format of our PDB-style files is described here.)

Timeline for d1ad0d2: