SCOPe 2.06: Domain d1ad0c2: 1ad0 C:108-213

Lineage for d1ad0c2 (1ad0 C:108-213)

Root: SCOPe 2.06
Class b: All beta proteins [48724] (177 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species)

Species Human (Homo sapiens) [TaxId:9606] [88569] (144 PDB entries)
including humanized antibodies (chimeric proteins with human constant domains)
SQ NA # humanized antibody ! Uniprot P01834 # KAC_HUMAN Ig kappa chain C region ! SQ P01834 # KAC_HUMAN Ig kappa chain C region. ! SQ NA # engineered antibody

Domain d1ad0c2: 1ad0 C:108-213 [21156]
Other proteins in same PDB: d1ad0a1, d1ad0b1, d1ad0b2, d1ad0c1, d1ad0d1, d1ad0d2
part of humanized Fab A5B7

Details for d1ad0c2

PDB Entry: 1ad0 (more details), 2.5 Å

PDB Description: fab fragment of engineered human monoclonal antibody a5b7

PDB Compounds: (C:) antibody a5b7 (light chain)

SCOPe Domain Sequences for d1ad0c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ad0c2 b.1.1.2 (C:108-213) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]}
tvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqds
kdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec

SCOPe Domain Coordinates for d1ad0c2:

Click to download the PDB-style file with coordinates for d1ad0c2.
(The format of our PDB-style files is described here.)

Timeline for d1ad0c2: