SCOPe 2.04: Domain d3iavb2: 3iav B:263-530

Lineage for d3iavb2 (3iav B:263-530)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.14: ClpP/crotonase [52095] (1 superfamily)
   core: 4 turns of (beta-beta-alpha)n superhelix

4. Superfamily c.14.1: ClpP/crotonase [52096] (5 families)

5. Family c.14.1.0: automated matches [191346] (1 protein)
   not a true family

6. Protein automated matches [190246] (46 species)
   not a true protein

7. Species Streptomyces coelicolor [TaxId:1902] [226767] (3 PDB entries)

8. Domain d3iavb2: 3iav B:263-530 [211558]
   automated match to d1vrga2
   complexed with so4

Details for d3iavb2

PDB Entry: 3iav, 1.75 Å

PDB Description: propionyl-coa carboxylase beta subunit, d422v

PDB Compounds: (B:) propionyl-CoA carboxylase complex B subunit

SCOPe Domain Sequences for d3iavb2:

Sequence; same for both SEQRES and ATOM records:

>d3iavb2 c.14.1.0 (B:263-530) automated matches {Streptomyces coelicolor [TaxId: 1902]}
lseppafpeeadlavtdedaeldtivpdsanqpydmhsviehvlddaeffetqplfapni
ltgfgrvegrpvgivanqpmqfagclditasekaarfvrtcdafnvpvltfvdvpgflpg
vdqehdgiirrgaklifayaeatvplitvitrkafggayvvmgskhlgadlnlawptaqi
avmgaqgavnilhrrtiadagddaeatrarliqeyedallnpytaaergyvdavimpsdt
rrhivrglrqlrtkreslppkkhgnipl

Timeline for d3iavb2:

• d3iavb2 first appeared in SCOPe 2.03
  
• d3iavb2 appears in SCOPe 2.05
  
• d3iavb2 appears in the current release, SCOPe 2.08