Lineage for d3i9ua_ (3i9u A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2015324Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
    multihelical; bundle
  4. 2015325Superfamily a.132.1: Heme oxygenase-like [48613] (5 families) (S)
    duplication: contains two structural repeats of 3-helical motif
  5. 2015326Family a.132.1.1: Eukaryotic type heme oxygenase [48614] (4 proteins)
    automatically mapped to Pfam PF01126
  6. 2015372Protein Heme oxygenase-1 (HO-1) [48615] (3 species)
  7. 2015430Species Norway rat (Rattus norvegicus) [TaxId:10116] [48617] (25 PDB entries)
    Uniprot P06762 11-222
  8. 2015447Domain d3i9ua_: 3i9u A: [211552]
    automated match to d1ix3a_
    complexed with dtu, hem

Details for d3i9ua_

PDB Entry: 3i9u (more details), 2.25 Å

PDB Description: Crystal structure of the rat heme oxygenase (HO-1) in complex with heme binding dithioerythritol (DTE)
PDB Compounds: (A:) Heme oxygenase 1

SCOPe Domain Sequences for d3i9ua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3i9ua_ a.132.1.1 (A:) Heme oxygenase-1 (HO-1) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
qdlsealkeatkevhiraensefmrnfqkgqvsregfklvmaslyhiytaleeeiernkq
npvyaplyfpeelhrraaleqdmafwygphwqeaipytpatqhyvkrlhevggthpellv
ahaytrylgdlsggqvlkkiaqkamalpssgeglafftfpsidnptkfkqlyrarmntle
mtpevkhrvteeaktafllnielfeelqallt

SCOPe Domain Coordinates for d3i9ua_:

Click to download the PDB-style file with coordinates for d3i9ua_.
(The format of our PDB-style files is described here.)

Timeline for d3i9ua_: