Lineage for d1ad0b2 (1ad0 B:114-211)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1513476Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1515183Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (6 species)
  7. 1515187Species Human (Homo sapiens) [TaxId:9606] [88575] (179 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
    Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3) ! SQ NA # humanized antibody ! Uniprot P01857 # IGHG1_HUMAN Ig gamma-1 chain C region ! SQ NA # engineered antibody
  8. 1515288Domain d1ad0b2: 1ad0 B:114-211 [21155]
    Other proteins in same PDB: d1ad0a1, d1ad0a2, d1ad0b1, d1ad0c1, d1ad0c2, d1ad0d1
    part of humanized Fab A5B7

Details for d1ad0b2

PDB Entry: 1ad0 (more details), 2.5 Å

PDB Description: fab fragment of engineered human monoclonal antibody a5b7
PDB Compounds: (B:) antibody a5b7 (heavy chain)

SCOPe Domain Sequences for d1ad0b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ad0b2 b.1.1.2 (B:114-211) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapcsrstsestaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtktytcnvdhkpsntkvdkrve

SCOPe Domain Coordinates for d1ad0b2:

Click to download the PDB-style file with coordinates for d1ad0b2.
(The format of our PDB-style files is described here.)

Timeline for d1ad0b2: