SCOP 1.61: Domain d1ad0b2: 1ad0 B:114-211

Lineage for d1ad0b2 (1ad0 B:114-211)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (180 species)

7. Species Fab A5B7 (engineered human construct), kappa L chain [49039] (1 PDB entry)

8. Domain d1ad0b2: 1ad0 B:114-211 [21155]
   Other proteins in same PDB: d1ad0a1, d1ad0b1, d1ad0c1, d1ad0d1

Details for d1ad0b2

PDB Entry: 1ad0, 2.5 Å

PDB Description: fab fragment of engineered human monoclonal antibody a5b7

SCOP Domain Sequences for d1ad0b2:

Sequence; same for both SEQRES and ATOM records:

>d1ad0b2 b.1.1.2 (B:114-211) Immunoglobulin (constant domains of L and H chains) {Fab A5B7 (engineered human construct), kappa L chain}
astkgpsvfplapcsrstsestaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtktytcnvdhkpsntkvdkrve

Timeline for d1ad0b2:

• d1ad0b2 first appeared (with stable ids) in SCOP 1.55
  
• d1ad0b2 appears in SCOP 1.59
  
• d1ad0b2 appears in SCOP 1.63
  
• d1ad0b2 appears in the current release, SCOPe 2.08