Lineage for d3i8ta_ (3i8t A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1532832Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 1532833Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 1534620Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 1534621Protein automated matches [190437] (29 species)
    not a true protein
  7. 1534842Species Mouse (Mus musculus) [TaxId:10090] [187609] (10 PDB entries)
  8. 1534853Domain d3i8ta_: 3i8t A: [211548]
    automated match to d2dyca_
    complexed with gol, lbt, na, peg

Details for d3i8ta_

PDB Entry: 3i8t (more details), 2.1 Å

PDB Description: n-terminal crd1 domain of mouse galectin-4 in complex with lactose
PDB Compounds: (A:) Galectin-4

SCOPe Domain Sequences for d3i8ta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3i8ta_ b.29.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ynptlpykrpipgglsvgmsvyiqgmakenmrrfhvnfavgqddgadvafhfnprfdgwd
kvvfntmqsgqwgkeekkksmpfqkgkhfelvfmvmpehykvvvngnsfyeyghrlpvqm
vthlqvdgdlelqsinflgg

SCOPe Domain Coordinates for d3i8ta_:

Click to download the PDB-style file with coordinates for d3i8ta_.
(The format of our PDB-style files is described here.)

Timeline for d3i8ta_: