SCOPe 2.03: Domain d3i75a2: 3i75 A:108-212

Lineage for d3i75a2 (3i75 A:108-212)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (12 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (237 PDB entries)

8. Domain d3i75a2: 3i75 A:108-212 [211543]
   Other proteins in same PDB: d3i75a1
   automated match to d2aabl2
   complexed with cl, gol, so4

Details for d3i75a2

PDB Entry: 3i75, 1.95 Å

PDB Description: Antibody Structure

PDB Compounds: (A:) antibody heavy chain

SCOPe Domain Sequences for d3i75a2:

Sequence; same for both SEQRES and ATOM records:

>d3i75a2 b.1.1.2 (A:108-212) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnsetdqd
skdstysmsstltltkdeyerhntytceathktstspivksfnra

Timeline for d3i75a2:

• d3i75a2 is new in SCOPe 2.03-stable
  
• d3i75a2 appears in SCOPe 2.04
  
• d3i75a2 appears in the current release, SCOPe 2.08