SCOP 1.61: Domain d1cloh2: 1clo H:114-214

Lineage for d1cloh2 (1clo H:114-214)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (180 species)

7. Species Fab A5B7 (mouse), kappa L chain [49038] (1 PDB entry)

8. Domain d1cloh2: 1clo H:114-214 [21153]
   Other proteins in same PDB: d1cloh1, d1clol1

Details for d1cloh2

PDB Entry: 1clo, 2.1 Å

PDB Description: anti-carcinoembryonic antigen monoclonal antibody a5b7

SCOP Domain Sequences for d1cloh2:

Sequence; same for both SEQRES and ATOM records:

>d1cloh2 b.1.1.2 (H:114-214) Immunoglobulin (constant domains of L and H chains) {Fab A5B7 (mouse), kappa L chain}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpssprpsetvtcnvahpasstkvdkkivprd

Timeline for d1cloh2:

• d1cloh2 first appeared (with stable ids) in SCOP 1.55
  
• d1cloh2 appears in SCOP 1.59
  
• d1cloh2 appears in SCOP 1.63
  
• d1cloh2 appears in the current release, SCOPe 2.08