Class a: All alpha proteins [46456] (290 folds) |
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) this domains follows the thioredoxin-like N-terminal domain |
Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins) |
Protein Class alpha GST [81349] (8 species) |
Species Human (Homo sapiens), (a1-1) [TaxId:9606] [47625] (35 PDB entries) Uniprot P08263 |
Domain d3i6ae2: 3i6a E:81-220 [211527] Other proteins in same PDB: d3i6aa1, d3i6ab1, d3i6ac1, d3i6ad1, d3i6ae1, d3i6af1, d3i6ag1, d3i6ah1 automated match to d1agsa1 complexed with gsh; mutant |
PDB Entry: 3i6a (more details), 1.98 Å
SCOPe Domain Sequences for d3i6ae2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3i6ae2 a.45.1.1 (E:81-220) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} lygkdikeralidmyiegiadlgemiimlpfcppeekdaklalikekiknryfpafekvl kshgqdylvgnklsradihlvellyyveeldsslissfpllkalktrisnlptvkkflqp gsprkpppdeiyvrtvynif
Timeline for d3i6ae2: