Lineage for d3i6ae1 (3i6a E:2-80)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1600407Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1600408Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1600814Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)
  6. 1600825Protein Class alpha GST [81360] (8 species)
  7. 1600838Species Human (Homo sapiens), (a1-1) [TaxId:9606] [52870] (27 PDB entries)
    Uniprot P08263
  8. 1600891Domain d3i6ae1: 3i6a E:2-80 [211526]
    Other proteins in same PDB: d3i6aa2, d3i6ab2, d3i6ac2, d3i6ad2, d3i6ae2, d3i6af2, d3i6ag2, d3i6ah2
    automated match to d1k3ya2
    complexed with gsh; mutant

Details for d3i6ae1

PDB Entry: 3i6a (more details), 1.98 Å

PDB Description: human gst a1-1 gimf mutant with glutathione
PDB Compounds: (E:) glutathione s-transferase a1

SCOPe Domain Sequences for d3i6ae1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3i6ae1 c.47.1.5 (E:2-80) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]}
aekpklhyfngrgrmestrwllaaagvefeekfiksaedldklrndgylmfqqvpmveid
gmklvqtrailnyiaskyn

SCOPe Domain Coordinates for d3i6ae1:

Click to download the PDB-style file with coordinates for d3i6ae1.
(The format of our PDB-style files is described here.)

Timeline for d3i6ae1: