Lineage for d3i6ad2 (3i6a D:81-220)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712830Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2712831Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2712832Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 2712845Protein Class alpha GST [81349] (8 species)
  7. 2712858Species Human (Homo sapiens), (a1-1) [TaxId:9606] [47625] (35 PDB entries)
    Uniprot P08263
  8. 2712889Domain d3i6ad2: 3i6a D:81-220 [211525]
    Other proteins in same PDB: d3i6aa1, d3i6ab1, d3i6ac1, d3i6ad1, d3i6ae1, d3i6af1, d3i6ag1, d3i6ah1
    automated match to d1agsa1
    complexed with gsh; mutant

Details for d3i6ad2

PDB Entry: 3i6a (more details), 1.98 Å

PDB Description: human gst a1-1 gimf mutant with glutathione
PDB Compounds: (D:) glutathione s-transferase a1

SCOPe Domain Sequences for d3i6ad2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3i6ad2 a.45.1.1 (D:81-220) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]}
lygkdikeralidmyiegiadlgemiimlpfcppeekdaklalikekiknryfpafekvl
kshgqdylvgnklsradihlvellyyveeldsslissfpllkalktrisnlptvkkflqp
gsprkpppdeiyvrtvynif

SCOPe Domain Coordinates for d3i6ad2:

Click to download the PDB-style file with coordinates for d3i6ad2.
(The format of our PDB-style files is described here.)

Timeline for d3i6ad2: