Class a: All alpha proteins [46456] (289 folds) |
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) this domains follows the thioredoxin-like N-terminal domain |
Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins) |
Protein Class alpha GST [81349] (8 species) |
Species Human (Homo sapiens), (a1-1) [TaxId:9606] [47625] (30 PDB entries) Uniprot P08263 |
Domain d3i69a2: 3i69 A:81-220 [211503] Other proteins in same PDB: d3i69a1, d3i69b1, d3i69c1, d3i69d1, d3i69e1, d3i69f1, d3i69g1, d3i69h1 automated match to d1agsa1 complexed with gsh; mutant |
PDB Entry: 3i69 (more details), 2.38 Å
SCOPe Domain Sequences for d3i69a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3i69a2 a.45.1.1 (A:81-220) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} lygkdikeralidmyiegiadlgemiimlpfcppeekdaklalikekiknryfpafekvl kshgqdylvgnklsradihlvellyyveeldsslissfpllkalktrisnlptvkkflqp gsprkpppdeiyvrtvynif
Timeline for d3i69a2: