Class b: All beta proteins [48724] (111 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (6 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
Protein Immunoglobulin (constant domains of L and H chains) [48972] (180 species) |
Species Fab LA-2 (mouse), kappa L chain [49037] (1 PDB entry) |
Domain d1fj1b2: 1fj1 B:115-213 [21149] Other proteins in same PDB: d1fj1a1, d1fj1b1, d1fj1c1, d1fj1d1, d1fj1e_, d1fj1f_ |
PDB Entry: 1fj1 (more details), 2.68 Å
SCOP Domain Sequences for d1fj1b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fj1b2 b.1.1.2 (B:115-213) Immunoglobulin (constant domains of L and H chains) {Fab LA-2 (mouse), kappa L chain} kttppsvyplapgcgdttgssvtlgclvkgyfpesvtvtwnsgslsssvhtfpallqsgl ytmsssvtvpsstwpsqtvtcsvahpassttvdkkleps
Timeline for d1fj1b2: