SCOPe 2.04: Domain d3i4kf2: 3i4k F:133-374

Lineage for d3i4kf2 (3i4k F:133-374)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families)
   binds metal ion (magnesium or manganese) in conserved site inside barrel
   N-terminal alpha+beta domain is common to this superfamily

5. Family c.1.11.0: automated matches [227196] (1 protein)
   not a true family

6. Protein automated matches [226923] (59 species)
   not a true protein

7. Species Corynebacterium glutamicum [TaxId:1718] [225728] (1 PDB entry)

8. Domain d3i4kf2: 3i4k F:133-374 [211487]
   Other proteins in same PDB: d3i4ka1, d3i4kb1, d3i4kc1, d3i4kd1, d3i4ke1, d3i4kf1, d3i4kg1, d3i4kh1
   automated match to d1f9ca1
   complexed with acy, mg

Details for d3i4kf2

PDB Entry: 3i4k, 2.2 Å

PDB Description: crystal structure of muconate lactonizing enzyme from corynebacterium glutamicum

PDB Compounds: (F:) muconate lactonizing enzyme

SCOPe Domain Sequences for d3i4kf2:

Sequence; same for both SEQRES and ATOM records:

>d3i4kf2 c.1.11.0 (F:133-374) automated matches {Corynebacterium glutamicum [TaxId: 1718]}
tvrdkvdvtwalgvlpldvavaeieerieefgnrsfklkmgagdpaedtrrvaelarevg
drvslridinarwdrrtalhylpilaeagvelfeqptpaddletlreitrrtnvsvmade
svwtpaealavvkaqaadvialkttkhgglleskkiaaiaeagglachgatslegpigta
aslqfaastkaisygtelfgpqllkdtyivqefeykdgqvaipqgpglgvdvdmdkvnfy
tr

Timeline for d3i4kf2:

• d3i4kf2 first appeared in SCOPe 2.03
  
• d3i4kf2 appears in SCOPe 2.05
  
• d3i4kf2 appears in the current release, SCOPe 2.08