Lineage for d3i4kc1 (3i4k C:5-132)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1649013Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 1649014Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 1649263Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 1649264Protein automated matches [226922] (67 species)
    not a true protein
  7. 1649408Species Corynebacterium glutamicum [TaxId:1718] [225727] (1 PDB entry)
  8. 1649411Domain d3i4kc1: 3i4k C:5-132 [211480]
    Other proteins in same PDB: d3i4ka2, d3i4kb2, d3i4kc2, d3i4kd2, d3i4ke2, d3i4kf2, d3i4kg2, d3i4kh2
    automated match to d1f9ca2
    complexed with acy, mg

Details for d3i4kc1

PDB Entry: 3i4k (more details), 2.2 Å

PDB Description: crystal structure of muconate lactonizing enzyme from corynebacterium glutamicum
PDB Compounds: (C:) muconate lactonizing enzyme

SCOPe Domain Sequences for d3i4kc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3i4kc1 d.54.1.0 (C:5-132) automated matches {Corynebacterium glutamicum [TaxId: 1718]}
dltiqkvesrildvplirphgfatttsteqhillvsvhlengvigygegvvpggpwwgge
svetmkalvdgylapvligravselagimadlervvararyakaavdvamhdawarslnv
pvrdllgg

SCOPe Domain Coordinates for d3i4kc1:

Click to download the PDB-style file with coordinates for d3i4kc1.
(The format of our PDB-style files is described here.)

Timeline for d3i4kc1: