Lineage for d3i4bb_ (3i4b B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2542316Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2543788Protein Glycogen synthase kinase-3 beta (Gsk3b) [69823] (2 species)
    CMGC group; GSK3 subfamily; serine/threonine kinase
  7. 2543789Species Human (Homo sapiens) [TaxId:9606] [69824] (51 PDB entries)
    Uniprot P49841 35-383 ! Uniprot P49841 35-384
  8. 2543840Domain d3i4bb_: 3i4b B: [211469]
    automated match to d1q5ka_
    complexed with z48

Details for d3i4bb_

PDB Entry: 3i4b (more details), 2.3 Å

PDB Description: crystal structure of gsk3b in complex with a pyrimidylpyrrole inhibitor
PDB Compounds: (B:) Glycogen synthase kinase-3 beta

SCOPe Domain Sequences for d3i4bb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3i4bb_ d.144.1.7 (B:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]}
kvttvvatpgqgpdrpqevsytdtkvigngsfgvvyqaklcdsgelvaikkvlqdkrfkn
relqimrkldhcnivrlryffyssgekkdevylnlvldyvpetvyrvarhysrakqtlpv
iyvklymyqlfrslayihsfgichrdikpqnllldpdtavlklcdfgsakqlvrgepnvs
yicsryyrapelifgatdytssidvwsagcvlaelllgqpifpgdsgvdqlveiikvlgt
ptreqiremnpnytefkfpqikahpwtkvfrprtppeaialcsrlleytptarltpleac
ahsffdelrdpnvklpngrdtpalfnfttqelssnpplatilippha

SCOPe Domain Coordinates for d3i4bb_:

Click to download the PDB-style file with coordinates for d3i4bb_.
(The format of our PDB-style files is described here.)

Timeline for d3i4bb_: