Lineage for d3i4ab_ (3i4a B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2580827Fold d.126: Pentein, beta/alpha-propeller [55908] (1 superfamily)
    duplication: composed of 5 alpha-beta(2)-alpha-beta units arranged around pseudo fivefold axis
  4. 2580828Superfamily d.126.1: Pentein [55909] (8 families) (S)
  5. 2580977Family d.126.1.0: automated matches [191334] (1 protein)
    not a true family
  6. 2580978Protein automated matches [190175] (10 species)
    not a true protein
  7. 2580998Species Human (Homo sapiens) [TaxId:9606] [187904] (35 PDB entries)
  8. 2581023Domain d3i4ab_: 3i4a B: [211467]
    automated match to d2jajb_
    complexed with ln5

Details for d3i4ab_

PDB Entry: 3i4a (more details), 1.9 Å

PDB Description: crystal structure of dimethylarginine dimethylaminohydrolase-1 (ddah- 1) in complex with n5-(1-iminopropyl)-l-ornithine
PDB Compounds: (B:) N(G),N(G)-dimethylarginine dimethylaminohydrolase 1

SCOPe Domain Sequences for d3i4ab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3i4ab_ d.126.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aafgrathavvralpeslgqhalrsakgeevdvaraerqhqlyvgvlgsklglqvvelpa
deslpdcvfvedvavvceetalitrpgapsrrkevdmmkealeklqlnivemkdenatld
ggdvlftgreffvglskrtnqrgaeiladtfkdyavstvpvadglhlksfcsmagpnlia
igssesaqkalkimqqmsdhrydkltvpddiaanciylnipnkghvllhrtpeeypesak
vyeklkdhmlipvsmselekvdglltccsvlinkk

SCOPe Domain Coordinates for d3i4ab_:

Click to download the PDB-style file with coordinates for d3i4ab_.
(The format of our PDB-style files is described here.)

Timeline for d3i4ab_: