SCOPe 2.03: Domain d3i48b_: 3i48 B:

Lineage for d3i48b_ (3i48 B:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.151: DNase I-like [56218] (1 superfamily)
   contains beta-sandwich; duplication of alpha+beta motif

4. Superfamily d.151.1: DNase I-like [56219] (4 families)

5. Family d.151.1.0: automated matches [191468] (1 protein)
   not a true family

6. Protein automated matches [190734] (7 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:561307] [225915] (4 PDB entries)

8. Domain d3i48b_: 3i48 B: [211465]
   automated match to d1zwxa1
   complexed with mg, po4; mutant

Details for d3i48b_

PDB Entry: 3i48, 1.8 Å

PDB Description: crystal structure of beta toxin from staphylococcus aureus f277a, p278a mutant with bound magnesium ions

PDB Compounds: (B:) Beta-hemolysin

SCOPe Domain Sequences for d3i48b_:

Sequence; same for both SEQRES and ATOM records:

>d3i48b_ d.151.1.0 (B:) automated matches {Staphylococcus aureus [TaxId: 561307]}
tdlklvshnvymlstvlypnwgqykradligqssyiknndvvifneafdngasdkllsnv
kkeypyqtpvlgrsqsgwdktegsysstvaedggvaivskypikekiqhvfksgcgfdnd
snkgfvytkiekngknvhvigthtqsedsrcgaghdrkiraeqmkeisdfvkkknipkde
tvyiggdlnvnkgtpefkdmlknlnvndvlyaghnstwdpqsnsiakynypngkpehldy
iftdkdhkqpkqlvnevvtekpkpwdvyaaayyyvyndfsdhypikaysk

Timeline for d3i48b_:

• d3i48b_ is new in SCOPe 2.03-stable
  
• d3i48b_ appears in SCOPe 2.04
  
• d3i48b_ appears in the current release, SCOPe 2.08