Lineage for d1ospl2 (1osp L:108-214)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 655938Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
  7. 656129Species Mouse (Mus musculus) [TaxId:10090] [88567] (311 PDB entries)
  8. 656204Domain d1ospl2: 1osp L:108-214 [21146]
    Other proteins in same PDB: d1osph1, d1osph2, d1ospl1, d1ospo_
    part of Fab 184.1 against OspA
    mutant

Details for d1ospl2

PDB Entry: 1osp (more details), 1.95 Å

PDB Description: crystal structure of outer surface protein a of borrelia burgdorferi complexed with a murine monoclonal antibody fab
PDB Compounds: (L:) fab 184.1

SCOP Domain Sequences for d1ospl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ospl2 b.1.1.2 (L:108-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

SCOP Domain Coordinates for d1ospl2:

Click to download the PDB-style file with coordinates for d1ospl2.
(The format of our PDB-style files is described here.)

Timeline for d1ospl2: