Class b: All beta proteins [48724] (93 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species) |
Species Fab 28B4 (mouse), kappa L chain [49035] (2 PDB entries) |
Domain d1kemh2: 1kem H:116-218 [21145] Other proteins in same PDB: d1kemh1, d1keml1 |
PDB Entry: 1kem (more details), 2.2 Å
SCOP Domain Sequences for d1kemh2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kemh2 b.1.1.2 (H:116-218) Immunoglobulin (constant domains of L and H chains) {Fab 28B4 (mouse), kappa L chain} tvssakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpav lqsdlytlsssvtvpssprpsetvtcnvahpasstkvdkkivp
Timeline for d1kemh2: