Lineage for d3i3oa_ (3i3o A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2846008Species Bacillus anthracis [TaxId:261594] [196544] (4 PDB entries)
  8. 2846023Domain d3i3oa_: 3i3o A: [211447]
    automated match to d1g0oc_
    complexed with cac, cl, mg, nae

Details for d3i3oa_

PDB Entry: 3i3o (more details), 2.06 Å

PDB Description: 2.06 angstrom resolution crystal structure of a short chain dehydrogenase from bacillus anthracis str. 'ames ancestor' in complex with nad-acetone
PDB Compounds: (A:) Short chain dehydrogenase

SCOPe Domain Sequences for d3i3oa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3i3oa_ c.2.1.0 (A:) automated matches {Bacillus anthracis [TaxId: 261594]}
fvtmpaqhqnkqpgieslmnplpqfedpnykgseklkgknvlitggdsgigravsiafak
eganiaiayldeegdanetkqyvekegvkcvllpgdlsdeqhckdivqetvrqlgslnil
vnnvaqqypqqgleyitaeqlektfrinifsyfhvtkaalshlkqgdviintasivayeg
netlidysatkgaivaftrslsqslvqkgirvngvapgpiwtplipssfdekkvsqfgsn
vpmqrpgqpyelapayvylassdssyvtgqmihvnggvivng

SCOPe Domain Coordinates for d3i3oa_:

Click to download the PDB-style file with coordinates for d3i3oa_.
(The format of our PDB-style files is described here.)

Timeline for d3i3oa_: