Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.126: Pentein, beta/alpha-propeller [55908] (1 superfamily) duplication: composed of 5 alpha-beta(2)-alpha-beta units arranged around pseudo fivefold axis |
Superfamily d.126.1: Pentein [55909] (8 families) |
Family d.126.1.0: automated matches [191334] (1 protein) not a true family |
Protein automated matches [190175] (10 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187904] (35 PDB entries) |
Domain d3i2eb_: 3i2e B: [211444] automated match to d2jajb_ |
PDB Entry: 3i2e (more details), 2.03 Å
SCOPe Domain Sequences for d3i2eb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3i2eb_ d.126.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} aafgrathavvralpeslgqhalrsakgeevdvaraerqhqlyvgvlgsklglqvvelpa deslpdcvfvedvavvceetalitrpgapsrrkevdmmkealeklqlnivemkdenatld ggdvlftgreffvglskrtnqrgaeiladtfkdyavstvpvadglhlksfcsmagpnlia igssesaqkalkimqqmsdhrydkltvpddiaanciylnipnkghvllhrtpeeypesak vyeklkdhmlipvsmselekvdglltccsvlinkk
Timeline for d3i2eb_: