| Class b: All beta proteins [48724] (165 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
| Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species) |
| Species Mouse (Mus musculus) [TaxId:10090] [88576] (330 PDB entries) |
| Domain d1kelh2: 1kel H:116-218 [21143] Other proteins in same PDB: d1kelh1, d1kell1, d1kell2 part of Fab 28B4 complexed with aah |
PDB Entry: 1kel (more details), 1.9 Å
SCOP Domain Sequences for d1kelh2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kelh2 b.1.1.2 (H:116-218) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
tvssakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpav
lqsdlytlsssvtvpssprpsetvtcnvahpasstkvdkkivp
Timeline for d1kelh2: