Lineage for d3i12d2 (3i12 D:140-363)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1928430Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 1928431Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (10 families) (S)
  5. 1928777Family d.142.1.0: automated matches [227184] (1 protein)
    not a true family
  6. 1928778Protein automated matches [226904] (27 species)
    not a true protein
  7. 1928850Species Salmonella typhimurium [TaxId:90371] [225724] (1 PDB entry)
  8. 1928854Domain d3i12d2: 3i12 D:140-363 [211424]
    Other proteins in same PDB: d3i12a1, d3i12b1, d3i12c1, d3i12d1
    automated match to d1ehib2
    complexed with adp

Details for d3i12d2

PDB Entry: 3i12 (more details), 2.2 Å

PDB Description: The crystal structure of the D-alanyl-alanine synthetase A from Salmonella enterica subsp. enterica serovar Typhimurium str. LT2
PDB Compounds: (D:) D-alanine-D-alanine ligase A

SCOPe Domain Sequences for d3i12d2:

Sequence, based on SEQRES records: (download)

>d3i12d2 d.142.1.0 (D:140-363) automated matches {Salmonella typhimurium [TaxId: 90371]}
dkdvakrllrdaglniapfitltrtnrhafsfaevesrlglplfvkpanqgssvgvskva
neaqyqqavalafefdhkvvveqgikgreiecavlgndnpqastcgeivlnsefyaydtk
yiddngaqvvvpaqipsevndkiraiaiqayqtlgcagmarvdvfltadnevvineintl
pgftnismypklwqasglgytdlisrlielalerhtannalktt

Sequence, based on observed residues (ATOM records): (download)

>d3i12d2 d.142.1.0 (D:140-363) automated matches {Salmonella typhimurium [TaxId: 90371]}
dkdvakrllrdaglniapfitltrtnrhafsfaevesrlglplfvkpanqgssvgvskva
neaqyqqavalafefdhkvvveqgikgreiecavlgndnpqastcgeivlnsefyiddng
aqvvvpaqipsevndkiraiaiqayqtlgcagmarvdvfltadnevvineintlpgftni
smypklwqasglgytdlisrlielalerhtannalktt

SCOPe Domain Coordinates for d3i12d2:

Click to download the PDB-style file with coordinates for d3i12d2.
(The format of our PDB-style files is described here.)

Timeline for d3i12d2: