Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (10 families) |
Family d.142.1.0: automated matches [227184] (1 protein) not a true family |
Protein automated matches [226904] (27 species) not a true protein |
Species Salmonella typhimurium [TaxId:90371] [225724] (1 PDB entry) |
Domain d3i12b2: 3i12 B:140-363 [211420] Other proteins in same PDB: d3i12a1, d3i12b1, d3i12c1, d3i12d1 automated match to d1ehib2 complexed with adp |
PDB Entry: 3i12 (more details), 2.2 Å
SCOPe Domain Sequences for d3i12b2:
Sequence, based on SEQRES records: (download)
>d3i12b2 d.142.1.0 (B:140-363) automated matches {Salmonella typhimurium [TaxId: 90371]} dkdvakrllrdaglniapfitltrtnrhafsfaevesrlglplfvkpanqgssvgvskva neaqyqqavalafefdhkvvveqgikgreiecavlgndnpqastcgeivlnsefyaydtk yiddngaqvvvpaqipsevndkiraiaiqayqtlgcagmarvdvfltadnevvineintl pgftnismypklwqasglgytdlisrlielalerhtannalktt
>d3i12b2 d.142.1.0 (B:140-363) automated matches {Salmonella typhimurium [TaxId: 90371]} dkdvakrllrdaglniapfitltrtnrhafsfaevesrlglplfvkpanqgssvgvskva neaqyqqavalafefdhkvvveqgikgreiecavlgndnpqastcgeivlqvvvpaqips evndkiraiaiqayqtlgcagmarvdvfltadnevvineintlpgftnismypklwqasg lgytdlisrlielalerhtannalktt
Timeline for d3i12b2: