SCOP 1.69: Domain d1kell2: 1kel L:113-217

Lineage for d1kell2 (1kel L:113-217)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88567] (277 PDB entries)

8. Domain d1kell2: 1kel L:113-217 [21142]
   Other proteins in same PDB: d1kelh1, d1kelh2, d1kell1
   part of Fab 28B4

Details for d1kell2

PDB Entry: 1kel, 1.9 Å

PDB Description: catalytic antibody 28b4 fab fragment complexed with hapten (1-[n-4'-nitrobenzyl-n-4'-carboxybutylamino] methylphosphonic acid)

SCOP Domain Sequences for d1kell2:

Sequence; same for both SEQRES and ATOM records:

>d1kell2 b.1.1.2 (L:113-217) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrn

Timeline for d1kell2:

• d1kell2 first appeared (with stable ids) in SCOP 1.55
  
• d1kell2 appears in SCOP 1.67
  
• d1kell2 appears in SCOP 1.71
  
• d1kell2 appears in the current release, SCOPe 2.08