Lineage for d3i12a2 (3i12 A:140-363)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2217268Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 2217269Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) (S)
  5. 2217671Family d.142.1.0: automated matches [227184] (1 protein)
    not a true family
  6. 2217672Protein automated matches [226904] (32 species)
    not a true protein
  7. 2217767Species Salmonella typhimurium [TaxId:90371] [225724] (1 PDB entry)
  8. 2217768Domain d3i12a2: 3i12 A:140-363 [211418]
    Other proteins in same PDB: d3i12a1, d3i12b1, d3i12c1, d3i12d1
    automated match to d1ehib2
    complexed with adp

Details for d3i12a2

PDB Entry: 3i12 (more details), 2.2 Å

PDB Description: The crystal structure of the D-alanyl-alanine synthetase A from Salmonella enterica subsp. enterica serovar Typhimurium str. LT2
PDB Compounds: (A:) D-alanine-D-alanine ligase A

SCOPe Domain Sequences for d3i12a2:

Sequence, based on SEQRES records: (download)

>d3i12a2 d.142.1.0 (A:140-363) automated matches {Salmonella typhimurium [TaxId: 90371]}
dkdvakrllrdaglniapfitltrtnrhafsfaevesrlglplfvkpanqgssvgvskva
neaqyqqavalafefdhkvvveqgikgreiecavlgndnpqastcgeivlnsefyaydtk
yiddngaqvvvpaqipsevndkiraiaiqayqtlgcagmarvdvfltadnevvineintl
pgftnismypklwqasglgytdlisrlielalerhtannalktt

Sequence, based on observed residues (ATOM records): (download)

>d3i12a2 d.142.1.0 (A:140-363) automated matches {Salmonella typhimurium [TaxId: 90371]}
dkdvakrllrdaglniapfitltrtnrhafsfaevesrlglplfvkpanqgssvgvskva
neaqyqqavalafefdhkvvveqgikgreiecavlgndnpqastcgeivlnsefydtkyi
ddngaqvvvpaqipsevndkiraiaiqayqtlgcagmarvdvfltadnevvineintlpg
ftnismypklwqasglgytdlisrlielalerhtannalktt

SCOPe Domain Coordinates for d3i12a2:

Click to download the PDB-style file with coordinates for d3i12a2.
(The format of our PDB-style files is described here.)

Timeline for d3i12a2: