SCOPe 2.04: Domain d3hzva1: 3hzv A:1-106

Lineage for d3hzva1 (3hzv A:1-106)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (19 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (388 PDB entries)

8. Domain d3hzva1: 3hzv A:1-106 [211406]
   Other proteins in same PDB: d3hzva2
   automated match to d1dqdl1
   complexed with mg, zn

Details for d3hzva1

PDB Entry: 3hzv, 1.9 Å

PDB Description: crystal structure of s73-2 antibody in complex with antigen kdo(2.8) kdo(2.4)kdo

PDB Compounds: (A:) S73-2 Fab (IgG1k) light chain

SCOPe Domain Sequences for d3hzva1:

Sequence; same for both SEQRES and ATOM records:

>d3hzva1 b.1.1.0 (A:1-106) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
divmtqspsslavsagekvtmsckssqsllnsrtrknylawyqqkpgqspklliywastr
esgvpdrftgsgsgtdftltissvqaedlavyyckqsynlrtfgggtklelk

Timeline for d3hzva1:

• d3hzva1 first appeared in SCOPe 2.03
  
• d3hzva1 appears in SCOPe 2.05
  
• d3hzva1 appears in the current release, SCOPe 2.08