SCOPe 2.06: Domain d3hx9b_: 3hx9 B:

Lineage for d3hx9b_ (3hx9 B:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families)
   dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers

5. Family d.58.4.0: automated matches [191316] (1 protein)
   not a true family

6. Protein automated matches [190081] (27 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:1773] [225795] (2 PDB entries)

8. Domain d3hx9b_: 3hx9 B: [211397]
   automated match to d1iujb_
   complexed with cl, hem

Details for d3hx9b_

PDB Entry: 3hx9, 1.75 Å

PDB Description: Structure of heme-degrader, MhuD (Rv3592), from Mycobacterium tuberculosis with two hemes bound in its active site

PDB Compounds: (B:) Protein Rv3592

SCOPe Domain Sequences for d3hx9b_:

Sequence; same for both SEQRES and ATOM records:

>d3hx9b_ d.58.4.0 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
pvvkinaievpagagpelekrfahrahavenspgflgfqllrpvkgeeryfvvthwesde
afqawangpaiaahaghranpvatgasllefevvldvg

Timeline for d3hx9b_:

• d3hx9b_ first appeared in SCOPe 2.03
  
• d3hx9b_ appears in SCOPe 2.05
  
• d3hx9b_ appears in SCOPe 2.07
  
• d3hx9b_ appears in the current release, SCOPe 2.08