SCOP 1.73: Domain d1ghfl2: 1ghf L:108-211

Lineage for d1ghfl2 (1ghf L:108-211)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88567] (311 PDB entries)

8. Domain d1ghfl2: 1ghf L:108-211 [21138]
   Other proteins in same PDB: d1ghfh1, d1ghfh2, d1ghfl1
   part of Fab GH1002

Details for d1ghfl2

PDB Entry: 1ghf, 2.7 Å

PDB Description: anti-anti-idiotype gh1002 fab fragment

PDB Compounds: (L:) anti-anti-idiotype gh1002 fab fragment

SCOP Domain Sequences for d1ghfl2:

Sequence; same for both SEQRES and ATOM records:

>d1ghfl2 b.1.1.2 (L:108-211) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]}
radaaqtvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnr

Timeline for d1ghfl2:

• d1ghfl2 first appeared (with stable ids) in SCOP 1.55
  
• d1ghfl2 appears in SCOP 1.71
  
• d1ghfl2 appears in SCOP 1.75
  
• d1ghfl2 appears in the current release, SCOPe 2.08