Lineage for d1clzh2 (1clz H:115-231)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 52912Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 53260Protein Immunoglobulin (constant domains of L and H chains) [48972] (161 species)
  7. 53874Species Fab MBR96 (mouse), kappa L chain [49032] (1 PDB entry)
  8. 53875Domain d1clzh2: 1clz H:115-231 [21137]
    Other proteins in same PDB: d1clzh1, d1clzl1

Details for d1clzh2

PDB Entry: 1clz (more details), 2.8 Å

PDB Description: igg fab (igg3, kappa) fragment (mbr96) complexed with lewis y nonoate methyl ester

SCOP Domain Sequences for d1clzh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1clzh2 b.1.1.2 (H:115-231) Immunoglobulin (constant domains of L and H chains) {Fab MBR96 (mouse), kappa L chain}
tttapsvyplvpgcsdtsgssvtlgclvkgyfpepvtvkwnygalssgvrtvssvlqsgf
yslsslvtvpsstwpsqtvicnvahpasktelikriepr

SCOP Domain Coordinates for d1clzh2:

Click to download the PDB-style file with coordinates for d1clzh2.
(The format of our PDB-style files is described here.)

Timeline for d1clzh2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1clzh1