SCOPe 2.05: Domain d1clyh2: 1cly H:114-227

Lineage for d1clyh2 (1cly H:114-227)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (6 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88575] (179 PDB entries)
   including humanized antibodies (chimeric proteins with human constant domains)
   Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3) ! SQ NA # humanized antibody ! Uniprot P01857 # IGHG1_HUMAN Ig gamma-1 chain C region ! SQ NA # engineered antibody

8. Domain d1clyh2: 1cly H:114-227 [21135]
   Other proteins in same PDB: d1clyh1, d1clyl1, d1clyl2
   part of humanized Fab CBR96
   complexed with non

Details for d1clyh2

PDB Entry: 1cly, 2.5 Å

PDB Description: igg fab (human igg1, kappa) chimeric fragment (cbr96) complexed with lewis y nonoate methyl ester

PDB Compounds: (H:) igg fab (human igg1, kappa)

SCOPe Domain Sequences for d1clyh2:

Sequence; same for both SEQRES and ATOM records:

>d1clyh2 b.1.1.2 (H:114-227) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapsskstsggtaalgclvkdyfpqpvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkrvep

Timeline for d1clyh2:

• d1clyh2 first appeared (with stable ids) in SCOP 1.55
  
• d1clyh2 appears in SCOPe 2.04
  
• d1clyh2 appears in SCOPe 2.06
  
• d1clyh2 appears in the current release, SCOPe 2.08