Lineage for d1clyh2 (1cly H:114-227)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 158799Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 159225Protein Immunoglobulin (constant domains of L and H chains) [48972] (180 species)
  7. 159726Species Fab CBR96 (mouse/human), kappa L chain [49031] (2 PDB entries)
  8. 159729Domain d1clyh2: 1cly H:114-227 [21135]
    Other proteins in same PDB: d1clyh1, d1clyl1

Details for d1clyh2

PDB Entry: 1cly (more details), 2.5 Å

PDB Description: igg fab (human igg1, kappa) chimeric fragment (cbr96) complexed with lewis y nonoate methyl ester

SCOP Domain Sequences for d1clyh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1clyh2 b.1.1.2 (H:114-227) Immunoglobulin (constant domains of L and H chains) {Fab CBR96 (mouse/human), kappa L chain}
astkgpsvfplapsskstsggtaalgclvkdyfpqpvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkrvep

SCOP Domain Coordinates for d1clyh2:

Click to download the PDB-style file with coordinates for d1clyh2.
(The format of our PDB-style files is described here.)

Timeline for d1clyh2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1clyh1