SCOP 1.55: Domain d1clyh2: 1cly H:114-227

Lineage for d1clyh2 (1cly H:114-227)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species)

7. Species Fab CBR96 (mouse/human), kappa L chain [49031] (2 PDB entries)

8. Domain d1clyh2: 1cly H:114-227 [21135]
   Other proteins in same PDB: d1clyh1, d1clyl1

Details for d1clyh2

PDB Entry: 1cly, 2.5 Å

PDB Description: igg fab (human igg1, kappa) chimeric fragment (cbr96) complexed with lewis y nonoate methyl ester

SCOP Domain Sequences for d1clyh2:

Sequence; same for both SEQRES and ATOM records:

>d1clyh2 b.1.1.2 (H:114-227) Immunoglobulin (constant domains of L and H chains) {Fab CBR96 (mouse/human), kappa L chain}
astkgpsvfplapsskstsggtaalgclvkdyfpqpvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkrvep

Timeline for d1clyh2:

• d1clyh2 appears in SCOP 1.57
  
• d1clyh2 appears in the current release, SCOPe 2.08