SCOPe 2.08: Domain d3huia1: 3hui A:0-105

Lineage for d3huia1 (3hui A:0-105)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families)

5. Family d.15.4.0: automated matches [191632] (1 protein)
   not a true family

6. Protein automated matches [191164] (24 species)
   not a true protein

7. Species Rhodopseudomonas palustris [TaxId:1076] [225824] (1 PDB entry)

8. Domain d3huia1: 3hui A:0-105 [211306]
   Other proteins in same PDB: d3huia2
   automated match to d3lb8c_
   complexed with fes; mutant

Details for d3huia1

PDB Entry: 3hui, 2.01 Å

PDB Description: crystal structure of the mutant a105r of [2fe-2s] ferredoxin in the class i cyp199a2 system from rhodopseudomonas palustris

PDB Compounds: (A:) ferredoxin

SCOPe Domain Sequences for d3huia1:

Sequence; same for both SEQRES and ATOM records:

>d3huia1 d.15.4.0 (A:0-105) automated matches {Rhodopseudomonas palustris [TaxId: 1076]}
makinfvdhtgetrtveveegatvmeaairnaipgveaecggacacatchvyvdeawrek
vggpspmeedmldfgydvrpnsrlscqikvsneldglivttperqr

Timeline for d3huia1:

• d3huia1 first appeared in SCOPe 2.03, called d3huia_
  
• d3huia1 appears in SCOPe 2.07