Lineage for d3hsrd_ (3hsr D:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1477565Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1478534Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1479947Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 1479948Protein automated matches [190154] (52 species)
    not a true protein
  7. 1480239Species Staphylococcus aureus [TaxId:426430] [225722] (4 PDB entries)
  8. 1480243Domain d3hsrd_: 3hsr D: [211301]
    automated match to d2bv6a1
    complexed with act, bt6, gol

Details for d3hsrd_

PDB Entry: 3hsr (more details), 1.9 Å

PDB Description: crystal structure of staphylococcus aureus protein sarz in mixed disulfide form
PDB Compounds: (D:) HTH-type transcriptional regulator sarZ

SCOPe Domain Sequences for d3hsrd_:

Sequence, based on SEQRES records: (download)

>d3hsrd_ a.4.5.0 (D:) automated matches {Staphylococcus aureus [TaxId: 426430]}
hmylskqlcflfyvsskeiikkytnylkeydltytgyivlmaiendeklnikklgervfl
dsgtltpllkklekkdyvvrtreekdernlqislteqgkaiksplaeisvkvfnefnise
reasdiinnlrnfvsknf

Sequence, based on observed residues (ATOM records): (download)

>d3hsrd_ a.4.5.0 (D:) automated matches {Staphylococcus aureus [TaxId: 426430]}
hmylskqlcflfyvsskeiikkytnylkeydltytgyivlmaiendeklnikklgervfl
dsgtltpllkklekkdyvvrtlqislteqgkaiksplaeisvkvfnefnisereasdiin
nlrnfvsknf

SCOPe Domain Coordinates for d3hsrd_:

Click to download the PDB-style file with coordinates for d3hsrd_.
(The format of our PDB-style files is described here.)

Timeline for d3hsrd_: