| Class b: All beta proteins [48724] (178 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein Immunoglobulin light chain lambda constant domain, CL-lambda [88570] (3 species) |
| Species Mouse (Mus musculus) [TaxId:10090] [88571] (22 PDB entries) Uniprot Q8N355 20-230 # 94% sequence identity; natural chimera: antibody light chain (Fab HYB3) |
| Domain d1yuha2: 1yuh A:110-212 [21130] Other proteins in same PDB: d1yuha1, d1yuhb1, d1yuhb2, d1yuhh1, d1yuhh2, d1yuhl1 part of an anti-nitrophenol Fab complexed with np |
PDB Entry: 1yuh (more details), 3 Å
SCOPe Domain Sequences for d1yuha2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yuha2 b.1.1.2 (A:110-212) Immunoglobulin light chain lambda constant domain, CL-lambda {Mouse (Mus musculus) [TaxId: 10090]}
gqpksspsvtlfppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtegmettqpsk
qsnnkymassyltlsarawerhasyscqvtheghtvekslsra
Timeline for d1yuha2: