SCOPe 2.05: Domain d1yuha2: 1yuh A:110-212

Lineage for d1yuha2 (1yuh A:110-212)

Root: SCOPe 2.05
Class b: All beta proteins [48724] (176 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein Immunoglobulin light chain lambda constant domain, CL-lambda [88570] (3 species)
Species Mouse (Mus musculus) [TaxId:10090] [88571] (21 PDB entries)
Uniprot Q8N355 20-230 # 94% sequence identity; natural chimera: antibody light chain (Fab HYB3)
Domain d1yuha2: 1yuh A:110-212 [21130]
Other proteins in same PDB: d1yuha1, d1yuhb1, d1yuhb2, d1yuhh1, d1yuhh2, d1yuhl1
part of an anti-nitrophenol Fab
complexed with np

Details for d1yuha2

PDB Description: fab fragment

PDB Compounds: (A:) 88c6/12 fab (light chain)

SCOPe Domain Sequences for d1yuha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yuha2 b.1.1.2 (A:110-212) Immunoglobulin light chain lambda constant domain, CL-lambda {Mouse (Mus musculus) [TaxId: 10090]}
gqpksspsvtlfppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtegmettqpsk
qsnnkymassyltlsarawerhasyscqvtheghtvekslsra

SCOPe Domain Coordinates for d1yuha2:

Click to download the PDB-style file with coordinates for d1yuha2.
(The format of our PDB-style files is described here.)

Timeline for d1yuha2: