Lineage for d1yuha2 (1yuh A:110-212)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1290587Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1293989Protein Immunoglobulin light chain lambda constant domain, CL-lambda [88570] (3 species)
  7. 1294075Species Mouse (Mus musculus) [TaxId:10090] [88571] (21 PDB entries)
    Uniprot Q8N355 20-230 # 94% sequence identity; natural chimera: antibody light chain (Fab HYB3)
  8. 1294101Domain d1yuha2: 1yuh A:110-212 [21130]
    Other proteins in same PDB: d1yuha1, d1yuhb1, d1yuhb2, d1yuhh1, d1yuhh2, d1yuhl1
    part of an anti-nitrophenol Fab
    complexed with np

Details for d1yuha2

PDB Entry: 1yuh (more details), 3 Å

PDB Description: fab fragment
PDB Compounds: (A:) 88c6/12 fab (light chain)

SCOPe Domain Sequences for d1yuha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yuha2 b.1.1.2 (A:110-212) Immunoglobulin light chain lambda constant domain, CL-lambda {Mouse (Mus musculus) [TaxId: 10090]}
gqpksspsvtlfppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtegmettqpsk
qsnnkymassyltlsarawerhasyscqvtheghtvekslsra

SCOPe Domain Coordinates for d1yuha2:

Click to download the PDB-style file with coordinates for d1yuha2.
(The format of our PDB-style files is described here.)

Timeline for d1yuha2: