SCOPe 2.03: Domain d3hsrb_: 3hsr B:

Lineage for d3hsrb_ (3hsr B:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.0: automated matches [191329] (1 protein)
   not a true family

6. Protein automated matches [190154] (41 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:426430] [225722] (4 PDB entries)

8. Domain d3hsrb_: 3hsr B: [211299]
   automated match to d2bv6a1
   complexed with act, bt6, gol

Details for d3hsrb_

PDB Entry: 3hsr, 1.9 Å

PDB Description: crystal structure of staphylococcus aureus protein sarz in mixed disulfide form

PDB Compounds: (B:) HTH-type transcriptional regulator sarZ

SCOPe Domain Sequences for d3hsrb_:

Sequence, based on SEQRES records:

>d3hsrb_ a.4.5.0 (B:) automated matches {Staphylococcus aureus [TaxId: 426430]}
gshmylskqlcflfyvsskeiikkytnylkeydltytgyivlmaiendeklnikklgerv
fldsgtltpllkklekkdyvvrtreekdernlqislteqgkaiksplaeisvkvfnefni
sereasdiinnlrnfvsknf

Sequence, based on observed residues (ATOM records):

>d3hsrb_ a.4.5.0 (B:) automated matches {Staphylococcus aureus [TaxId: 426430]}
gshmylskqlcflfyvsskeiikkytnylkeydltytgyivlmaiendeklnikklgerv
fldsgtltpllkklekkdyvvrtrlqislteqgkaiksplaeisvkvfnefnisereasd
iinnlrnfvsknf

Timeline for d3hsrb_:

• d3hsrb_ is new in SCOPe 2.03-stable
  
• d3hsrb_ appears in SCOPe 2.04
  
• d3hsrb_ appears in the current release, SCOPe 2.08, called d3hsrb1