SCOPe 2.06: Domain d3hseb1: 3hse B:7-139

Lineage for d3hseb1 (3hse B:7-139)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.0: automated matches [191329] (1 protein)
   not a true family

6. Protein automated matches [190154] (68 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:426430] [225722] (4 PDB entries)

8. Domain d3hseb1: 3hse B:7-139 [211297]
   Other proteins in same PDB: d3hsea2, d3hseb2
   automated match to d2bv6a1

Details for d3hseb1

PDB Entry: 3hse, 2.9 Å

PDB Description: crystal structure of staphylococcus aureus protein sarz in reduced form

PDB Compounds: (B:) HTH-type transcriptional regulator sarZ

SCOPe Domain Sequences for d3hseb1:

Sequence, based on SEQRES records:

>d3hseb1 a.4.5.0 (B:7-139) automated matches {Staphylococcus aureus [TaxId: 426430]}
ylskqlcflfyvsskeiikkytnylkeydltytgyivlmaiendeklnikklgervflds
gtltpllkklekkdyvvrtreekdernlqislteqgkaiksplaeisvkvfnefnisere
asdiinnlrnfvs

Sequence, based on observed residues (ATOM records):

>d3hseb1 a.4.5.0 (B:7-139) automated matches {Staphylococcus aureus [TaxId: 426430]}
ylskqlcflfyvsskeiikkytnylkeydltytgyivlmaiendeklnikklgervflds
gtltpllkklekkdyvvteqgkaiksplaeisvkvfnefnisereasdiinnlrnfvs

Timeline for d3hseb1:

• d3hseb1 first appeared in SCOPe 2.03, called d3hseb_
  
• d3hseb1 was called d3hseb_ in SCOPe 2.05
  
• d3hseb1 appears in SCOPe 2.07
  
• d3hseb1 appears in the current release, SCOPe 2.08