Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
Superfamily c.14.1: ClpP/crotonase [52096] (5 families) |
Family c.14.1.0: automated matches [191346] (1 protein) not a true family |
Protein automated matches [190246] (54 species) not a true protein |
Species Thermus thermophilus HB8 [TaxId:300852] [225694] (2 PDB entries) |
Domain d3hrxb_: 3hrx B: [211291] automated match to d4fzwc_ |
PDB Entry: 3hrx (more details), 1.85 Å
SCOPe Domain Sequences for d3hrxb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hrxb_ c.14.1.0 (B:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]} mvlkerqdgvlvltlnrpeklnaitgelldalyaalkegeedrevrallltgagrafsag qdltefgdrkpdyeahlrrynrvvealsglekplvvavngvaagagmslalwgdlrlaav gasfttafvriglvpdsglsfllprlvglakaqellllsprlsaeealalglvhrvvpae klmeealslakelaqgptrayaltkkllletyrlsltealaleavlqgqagqtqdheegv rafrekrpprfqgr
Timeline for d3hrxb_: