Lineage for d1yuhl2 (1yuh L:110-212)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2356941Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2360924Protein Immunoglobulin light chain lambda constant domain, CL-lambda [88570] (3 species)
  7. 2361010Species Mouse (Mus musculus) [TaxId:10090] [88571] (22 PDB entries)
    Uniprot Q8N355 20-230 # 94% sequence identity; natural chimera: antibody light chain (Fab HYB3)
  8. 2361031Domain d1yuhl2: 1yuh L:110-212 [21128]
    Other proteins in same PDB: d1yuha1, d1yuhb1, d1yuhb2, d1yuhh1, d1yuhh2, d1yuhl1
    part of an anti-nitrophenol Fab
    complexed with np

Details for d1yuhl2

PDB Entry: 1yuh (more details), 3 Å

PDB Description: fab fragment
PDB Compounds: (L:) 88c6/12 fab (light chain)

SCOPe Domain Sequences for d1yuhl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yuhl2 b.1.1.2 (L:110-212) Immunoglobulin light chain lambda constant domain, CL-lambda {Mouse (Mus musculus) [TaxId: 10090]}
gqpksspsvtlfppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtegmettqpsk
qsnnkymassyltlsarawerhasyscqvtheghtvekslsra

SCOPe Domain Coordinates for d1yuhl2:

Click to download the PDB-style file with coordinates for d1yuhl2.
(The format of our PDB-style files is described here.)

Timeline for d1yuhl2: