Lineage for d1yuhl2 (1yuh L:110-212)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 52912Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 53260Protein Immunoglobulin (constant domains of L and H chains) [48972] (161 species)
  7. 53643Species Fab anti-nitrophenol (mouse/human), lambda L chain [49030] (1 PDB entry)
  8. 53647Domain d1yuhl2: 1yuh L:110-212 [21128]
    Other proteins in same PDB: d1yuha1, d1yuhb1, d1yuhh1, d1yuhl1

Details for d1yuhl2

PDB Entry: 1yuh (more details), 3 Å

PDB Description: fab fragment

SCOP Domain Sequences for d1yuhl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yuhl2 b.1.1.2 (L:110-212) Immunoglobulin (constant domains of L and H chains) {Fab anti-nitrophenol (mouse/human), lambda L chain}
gqpksspsvtlfppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtegmettqpsk
qsnnkymassyltlsarawerhasyscqvtheghtvekslsra

SCOP Domain Coordinates for d1yuhl2:

Click to download the PDB-style file with coordinates for d1yuhl2.
(The format of our PDB-style files is described here.)

Timeline for d1yuhl2: