Lineage for d1ngqh2 (1ngq H:121-220)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 52912Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 53260Protein Immunoglobulin (constant domains of L and H chains) [48972] (161 species)
  7. 53891Species Fab N1G9 (mouse/human), kappa L chain [49028] (2 PDB entries)
  8. 53894Domain d1ngqh2: 1ngq H:121-220 [21125]
    Other proteins in same PDB: d1ngqh1, d1ngql1

Details for d1ngqh2

PDB Entry: 1ngq (more details), 2.4 Å

PDB Description: n1g9 (igg1-lambda) fab fragment

SCOP Domain Sequences for d1ngqh2:

Sequence, based on SEQRES records: (download)

>d1ngqh2 b.1.1.2 (H:121-220) Immunoglobulin (constant domains of L and H chains) {Fab N1G9 (mouse/human), kappa L chain}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpsspwpsetvtcnvahpasstkvdkkivpr

Sequence, based on observed residues (ATOM records): (download)

>d1ngqh2 b.1.1.2 (H:121-220) Immunoglobulin (constant domains of L and H chains) {Fab N1G9 (mouse/human), kappa L chain}
akttppsvyplapgssmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytls
ssvtvpsspwpsetvtcnvahpasstkvdkkivpr

SCOP Domain Coordinates for d1ngqh2:

Click to download the PDB-style file with coordinates for d1ngqh2.
(The format of our PDB-style files is described here.)

Timeline for d1ngqh2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ngqh1