SCOPe 2.06: Domain d1ngql2: 1ngq L:110-211

Lineage for d1ngql2 (1ngq L:110-211)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin light chain lambda constant domain, CL-lambda [88570] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88571] (21 PDB entries)
   Uniprot Q8N355 20-230 # 94% sequence identity; natural chimera: antibody light chain (Fab HYB3)

8. Domain d1ngql2: 1ngq L:110-211 [21124]
   Other proteins in same PDB: d1ngqh1, d1ngqh2, d1ngql1
   part of Fab N1G9
   complexed with so4

Details for d1ngql2

PDB Entry: 1ngq, 2.4 Å

PDB Description: n1g9 (igg1-lambda) fab fragment

PDB Compounds: (L:) n1g9 (igg1-lambda)

SCOPe Domain Sequences for d1ngql2:

Sequence; same for both SEQRES and ATOM records:

>d1ngql2 b.1.1.2 (L:110-211) Immunoglobulin light chain lambda constant domain, CL-lambda {Mouse (Mus musculus) [TaxId: 10090]}
gqpksspsvtlfppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpsk
qsnnkymassyltltarawerhssyscqvtheghtvekslsr

Timeline for d1ngql2:

• d1ngql2 first appeared (with stable ids) in SCOP 1.55
  
• d1ngql2 appears in SCOPe 2.05
  
• d1ngql2 appears in SCOPe 2.07
  
• d1ngql2 appears in the current release, SCOPe 2.08