SCOP 1.63: Domain d1ngql2: 1ngq L:110-211

Lineage for d1ngql2 (1ngq L:110-211)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)

7. Species Fab N1G9 (mouse/human), kappa L chain [49028] (2 PDB entries)

8. Domain d1ngql2: 1ngq L:110-211 [21124]
   Other proteins in same PDB: d1ngqh1, d1ngql1

Details for d1ngql2

PDB Entry: 1ngq, 2.4 Å

PDB Description: n1g9 (igg1-lambda) fab fragment

SCOP Domain Sequences for d1ngql2:

Sequence; same for both SEQRES and ATOM records:

>d1ngql2 b.1.1.2 (L:110-211) Immunoglobulin (constant domains of L and H chains) {Fab N1G9 (mouse/human), kappa L chain}
gqpksspsvtlfppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpsk
qsnnkymassyltltarawerhssyscqvtheghtvekslsr

Timeline for d1ngql2:

• d1ngql2 first appeared (with stable ids) in SCOP 1.55
  
• d1ngql2 appears in SCOP 1.61
  
• d1ngql2 appears in SCOP 1.65
  
• d1ngql2 appears in the current release, SCOPe 2.08