SCOPe 2.05: Domain d3hqna2: 3hqn A:88-186

Lineage for d3hqna2 (3hqn A:88-186)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.58: PK beta-barrel domain-like [50799] (1 superfamily)
   barrel, closed; n=7, S=10; complex topology

4. Superfamily b.58.1: PK beta-barrel domain-like [50800] (2 families)

5. Family b.58.1.1: Pyruvate kinase beta-barrel domain [50801] (1 protein)
   this domain interrupts beta/alpha-barrel domain
   C-terminal domain is alpha/beta

6. Protein Pyruvate kinase (PK) [50802] (6 species)

7. Species Trypanosome (Leishmania mexicana) [TaxId:5665] [50805] (11 PDB entries)

8. Domain d3hqna2: 3hqn A:88-186 [211225]
   Other proteins in same PDB: d3hqna1, d3hqna3, d3hqnd1, d3hqnd3
   automated match to d1pkla1
   complexed with gol, k, so4

Details for d3hqna2

PDB Entry: 3hqn, 2 Å

PDB Description: Apo crystal structure of Leishmania mexicana(LmPYK)pyruvate kinase

PDB Compounds: (A:) pyruvate kinase

SCOPe Domain Sequences for d3hqna2:

Sequence; same for both SEQRES and ATOM records:

>d3hqna2 b.58.1.1 (A:88-186) Pyruvate kinase (PK) {Trypanosome (Leishmania mexicana) [TaxId: 5665]}
eirtgqfvggdavmergatcyvttdpafadkgtkdkfyidyqnlskvvrpgnyiyiddgi
lilqvqshedeqtlectvtnshtisdrrgvnlpgcdvdl

Timeline for d3hqna2:

• d3hqna2 first appeared in SCOPe 2.03
  
• d3hqna2 appears in SCOPe 2.04
  
• d3hqna2 appears in SCOPe 2.06
  
• d3hqna2 appears in the current release, SCOPe 2.08